Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|556269.4.peg.1769 Cysteine synthase (EC 2.5.1.47) [Oxalobacter formigenes OXCC13]
MSNIAKSATDLIGNTPLLEISRFGKHVDADATILAKLEYFNPAGSAKDRIAKAMIDAAEA
DGKLIPGSTIIEPTSGNTGIALAAVGAARGYRVIITMPETMSVERQKLIRGYGADLVLTE
GAKGMKGAIEKAQELAATIPGGFVPLQFANPANPAIHKATTGPEIWRDTDGKVDIFVAGV
GTGGTLTGVGKYLKEQNPAVQVVAIEPAASPVLAGGKPGPHKIQGIGAGFIPEALDVNVF
DEVIGVPNDAAFATAKTLAHAEGVLVGISSGAALWAASELAKRPENRGKTIVVLLADNGE
RYLSTDLFSN