Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|553594.3.peg.1812 Cysteine desulfurase (EC 2.8.1.7) [Staphylococcus aureus A9765]
MINEREVFILIYLDNAATTKAFEEVLDTYLKVNQSMYYNPNSPHKAGLQANQLLQQAKTQ
INAMINSKTNYDVVFTSGATESNNLALKGIAYRKFDTAKEIITSVLEHPSVLEVVRYLEA
HEGFKVKYVDVKKDGSINLEHFKELMSDKVGLVTCMYVNNVTGQIQPIPQMAKVIKNYPK
AHFHVDAVQAFGKISMDLNNIDSISLSGHKFNGLKGQGVLLVNHIQNVEPTVHGGGQEYG
VRSGTVNLPNDIAMVKAMKIANENFEALNAFVTELNNDVRQFLNKYHGVYINSSTSGSPF
VLNISFPGVKGEVLVNAFSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSF
GATTTKEDIARFKEIFIIIYEEIKELLK