Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|553590.4.peg.94 membrane protein, putative [Staphylococcus aureus A9754]
MTSLKERDYFFDNARAILILLVVFGHMLQPYTSGDKYLSALYLVIYSFHMPTFLFISGYF
AKNIDKPYYLEKISKRLIVPYMIFFAFFSIYYFLTGKSDELQLDPFNPVFALWFLITLFF
FHVILVIVRRFNPYKVLSVSIIISIGAGFSDNIDSYLSISRTIVFFPIFYLGYIFTKKHT
AIFKNKKLIPVSIITFILFFIVYVIHPINADWLLGSSPYTSLENEGQSIFSPFKRLILYG
IILIAMTAFLNLMSTKKKLYTYIGSRTLYVYLLHGLIIGIVRGFEWYPFDNPISLMTYLY
LISISVIIVYVLSTNFVCKWTNPIINLQRPSQFKDS