Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|553588.3.peg.2631 putative esterase [Staphylococcus aureus A9719]
MFKNDQDVERFFYKREIENRKKHKQPSTLNVKANLEKLSLDDMQVFRFNFRHQIDKKILY
IHGGFNALQPSPFHWRLLDKITLSTLYEVVLPIYPKTPEFHIDDTFQAIQRVYDQLVSEV
GHQNVVVMGDGSGGALALSFVQSLLDNQQPLPNKLYLISPILDATLSNKDISDALIEQDA
VLSQFGVNEIMKKWANGLPLTDKRISPINGTIEGLPPVYMFGGGREMTHPDMKLFEQMML
QHHQYIEFYDYPKMVHDFPIYPIRQSHKAIKQIAKSIDEDVTQNN