Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|550682.3.peg.2652 Acetolactate synthase small subunit (EC 2.2.1.6) [Escherichia coli B799]
MMQHQVNVSARFNPETLERVLRVVRHRGFHVCSMNMAAASDAQNINIELTVASPRSVDLL
FSQLNKLVDVAHVAICQSTTTSQQIRA