Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|547043.8.peg.1884 Threonine dehydratase, catabolic (EC 4.3.1.19) [Bifidobacterium pseudocatenulatum DSM 20438 = JCM 1200]
MEQNEVLKALQRDHAAELKLAAERLKGTARHTEIIPSKVLSDMTGHEILLKPENLQVTGS
FKIRGAYNKIASLSDEQLARGIVTASAGNHAQGVAYAARERGAKATICMPQITPPLKVDA
TKAYGADVVLYGEVFDESAARAQELSDTEGMIYVPPFDDYEVLCGQGTIGLEILEDVPNV
TDVVVPLGGGGLGAGVALAIKTFKPEVRVIGAIPEGSPAWKNSLAAGHVVAADQVRTSAE
GVAVKRPGDLTFALLNEFLDDIVTVTERDINEMILLMLEKHKLVVEAAGAVSLAALEHLN
LRSRKFAEAKGPHVVVPIMSGGNEDTVSIGAVIQKGMITRGRIMHFEVELPDTPGQLVKV
ATLLAEQRANVIALDHDQFKASSHYANAVALGVTVETNGPDHIDRVLEALREAGFQPKRI
Y