Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|546275.3.peg.1380 Threonine dehydratase, catabolic (EC 4.3.1.19) [Fusobacterium periodonticum ATCC 33693]
MHKLYDFMEARERLGTVIVKTKLIHSPVFSEESGNEVYLKPENLQKTGSFKIRGAYNKIA
KLSDEEKKKGVIASSAGNHAQGVAYAAKKLGIKAVIVMPQHTPLIKVEATRRYGAEVVLH
GEVYDDAYKKALELQKENGYVFVHPFNDEEVLEGQGTIALEILDELPNADIILVPLGGGG
LVSGIACAAKLKNPQIKVIGVEPEGAASALAALQKGEVVELKEANTIADGTAVKRIGEIN
FEYIKKYVDDIITVSDYELMETFLLLVEKHKIVAENSGILPVAAAKKLNVKGKKIVAVVS
GGNIDVLTISSMINKGLIMRGRIFTFSVQLADKPGELLKVSEILSKQNANVIKLEHNQFK
NLSRFKDVELQVTVETNGEEHIHKIIETFKKEGYEIERLNSQM