Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|483218.5.peg.1781 Cysteine synthase (EC 2.5.1.47) [Bacteroides pectinophilus ATCC 43243]
MGKIYENVAELIGKTPLLHANNFEKKRGVEANIFAKLEYFNPAGSVKDRVALAMINDAEQ
RGILKEGSVIIEPTSGNTGIGLASIAAARGYRIILTMPETMSIERRNLLKAYGAELVLTE
GSKGMKGAIAKAEELAKETPDSFIPGQFVNPANPAAHKATTGPEIWEDTEGNVDIFIAGV
GTGGTVTGIGEFLKSKNPDIKVIAVEPAGSPVLSTGKGGPHMIQGIGAGFVPDVLNTKIY
DEIVTIENEDAFDAGREFAKAEGILVGISSGAALHAAEIVAARPENKGRNIVVLLPDTGD
RYLSTALFNR