Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|457424.5.peg.3487 Cysteine synthase (EC 2.5.1.47) [Bacteroides fragilis 3_1_12]
MAKIAKKLTELIGHTPLMELSGYSRKYGLEENIIAKLESFNPAGSVKDRVALSMIEDAEK
RGVLKPGATIIEPTSGNTGVGLAMVATIKGYQLILTMPETMSLERRNLLKALGAQIVLTD
GLAGMAGSIAKAEELKDSIPGSVILQQFENPSNAEVHTRFTGEEIWQDTDGQVAVFVAGV
GTGGTVCGVARALKKHNPDVYIVAVEPASSPVLEGGKAAPHRIQGIGANFVPGIYDASVV
DEIMPVPDDEAIRGGRELASTEGLLAGISSGAVVYAARKLAERPEFKGKRIVALLPDTGE
RYLSTELFAFDAYPLD