Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|451515.3.peg.476 Type I restriction-modification system, DNA-methyltransferase subunit M (EC 2.1.1.72) [Staphylococcus aureus subsp. aureus USA300_FPR3757]
MSITEKQRQQQAELHKKLWSIANDLRGNMDASEFRNYILGLIFYRFLSEKAEQEYADALS
GEDITYQEAWADEEYREDLKAELIDQVGYFIEPEDLFSAMIREIETQDFDIEHLATAIRK
VETSTLGEESENDFIGLFSDMDLSSTRLGNNVKERTALISKVMVNLDDLPFVHSDMEIDM
LGDAYEFLIGRFAATAGKKAGEFYTPQQVSKILAKIVTDGKDKLRHVYDPTCGSGSLLLR
VGKETQVYRYFGQERNNTTYNLARMNMLLHDVRYENFDIRNDDTLENPAFLGNTFDAVIA
NPPYSAKWTADSKFENDERFSGYGKLAPKSKADFAFIQHMVHYLDDEGTMAVVLPHGVLF
RGAAEGVIRRYLIEEKNYLEAVIGLPANIFYGTSIPTCILVFKKCRQQDDNVLFIDASND
FEKGKNQNHLSDAQVERIIDTYKRKETIDKYSYSATLQEIADNDYNLNIPRYVDTFEEEA
PIDLDQVQQDLKNIDKEIAEIEQEINAYLKELGVLKDE