Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|451515.3.peg.294 Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) (EC 1.14.12.17) [Staphylococcus aureus subsp. aureus USA300_FPR3757]
MLTEQEKDIIKQTVPLLKEKGTEITSIFYPKMFKAHPELLNMFNQTNQKRGMQSSALAQA
VMAAAVNIDNLSVIKPVIMPVAYKHCALQVYAEHYPIVGKNLLKAIQDVTGLEENDPVIQ
AWAKAYGVIADVFIQIEKEIYDQMMWIGFKPFKITNIKQESEDIKSFTVETEEYDFSEFT
PGQYITVDVSSDKLPYRAKRHYSIVSGEKNHLTFGVKRDVTTEHEGEVSTILHDEIKEGD
MINLAAPVGGFVLENTTEPQLFLGSGIGVTPLVAMYEAASAKGLDTQMVQVAENEQHLPF
KDNFNSIASHHDNAKLYTHLKDKQGYIGAEELQVFLANKPEIYICGGTKFLQSMIEALKS
LNYDMDRVHYETFIPRLSVAV