Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|451515.3.peg.2172 Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1) [Staphylococcus aureus subsp. aureus USA300_FPR3757]
MHHVNKYFNQTMVIEALKMSFYKLNLKQLIKNPIMFVVEVGMILTLILICFPDIFGTSYL
SRGYLITIFIILLITILFANFSEAFAEGRGKAQADSLRQAQSNLTARLIEENGAYRIVNA
TELKAGQNIRVENGETIPADGVVINGLATVDESAITGESAPVIKESGGDFDGVIGGTLVT
SDWLEIRVESEAGTSFLDKMIALVEGAERNKTPNEIALFTLLTTLTIIFLVVIVTLYPIA
SYLHLILPIAMLIALTVCLIPTTIGGLLSAIGIAGMDRVTQFNVLAKSGRAVEVCGDVDV
MILDKTGTITYGNRIASEFLPVNQQMLEKLIVAAYMSSIYDDTPEGKSIVRLAKQMYINE
LPKDIDGTYKPFTAETRMSGIITNEISVFKGAPNSMINLVKQQQGNIPLNIESLCMDVSS
KGGTPLIVIENNVMLGVIYLKDVIKDGLVERFTELRKMGIETVMCTGDNALTAATIAKEA
GVDRFVAECKPEDKIKVIKDEQAKGHIVAMTGDGTNDAPALAQANIGLAMNSGTISAKEA
ANLIDLDSNPTKLIEVVKIGKQLLMTRGALTTFSLANDVAKYFAILPALMMSTIPEMTSL
NIMHLSSPKSAIISALIFNALIIVALIPIAMKGVKVKGYSIDRIFINNMLIYGLGGLIVP
FLGIKLIDMIVQFFV