Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|451515.3.peg.2052 Phage endolysin N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) # truncated [Staphylococcus aureus subsp. aureus USA300_FPR3757]
MPAGYTLDKNNVPYKKETGYYTVANVKGNNVRDGYSTNSRITGVLPNNATIKYDGAYCIN
GYRWITYIANSGQRRYIATGEVDKAGNRISSFGKFSAV