Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|450394.6.peg.1851 putative esterase [Staphylococcus aureus subsp. aureus USA300_TCH959]
MFKNDQDVERFFYKREIENRKKHKQPSTLNVKANLEKLSLDDMQVFRFNFRHQIDKKILY
IHGGFNALQPSPFHWRLLDKITLSTLYEVVLPIYPKTPEFHIDDTFQAIQRVYDQLVSEV
GHQNVVVMGDGSGGALALSFVQSLLDNQQPLPNKLYLISPILDATLSNKDISDALIEQDA
VLSQFGVNEIMKKWANGLPLTDKRISPINGTIEGLPPVYMFGGGREMTHPDMKLFEQMML
QHHQYIEFYDYPKMVHDFPIYPIRQSHKAIKQIAKSIDEDVTQNN