Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|426430.8.peg.950 Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type [Staphylococcus aureus subsp. aureus str. Newman]
MKFKYHISQQETVKTFLARHDFSKKTVSAIKNNGALIVNDEPVTVRKQLMTNDILEIHLP
REIPSVNLIPYARKLEVLYEDAFIIIVTKPNNQNCTPSREHPHESLIEQVLYHCQEHGEN
INPHIVTRLDRNTTGIVIFAKYGHIHHLFSKVNLKKIYTCLVYGKTHTSGIIEANIRRSK
DRIITREVASDGKYAKTSYEVINQNDKYSLCKVHLHTGRTHQIRVHFQHIGHPIVGDSLY
DGFHDKIHGQVLQCTQIYFVHPINKNNIYITIDYKQLLKLFNQL