Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|426430.8.peg.513 possible tetrapyrrole methyltransferase domain / Nucleoside triphosphate pyrophosphohydrolase MazG (EC 3.6.1.8) [Staphylococcus aureus subsp. aureus str. Newman]
MAHTITIVGLGNYGIDDLPLGIYKFLKTQDKVYARTLDHPVIESLQDELTFQSFDHVYEA
HNQFEDVYIDIVAQLVEAANEKDIVYAVPGHPRVAETTTVKLLALAKDNTDIDVKVLGGK
SFIDDVFEAVNVDPNDGFTLLDATSLQEVTLNVRTHTLITQVYSAMVAANLKITLMERYP
DDYPVQIVTGARSDGADNVVTCPLYELDHDENAFNNLTSVFVPKIITSTYLYHDFDFATE
VIDTLVDEDKGCPWDKVQTHETLKRYLLEETFELFEAIDNEDDWHMIEELGDILLQVLLH
TSIGKKEGYIDIKEVITSLNAKMIRRHPHIFGDANAETIDDLKEIWSKAKDAEGKQPRVK
FEKVFAEHFLNLYEKTKDKSFDEAALKQWLEKGESNT