Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|426430.8.peg.2708 2-dehydropantoate 2-reductase (EC 1.1.1.169) [Staphylococcus aureus subsp. aureus str. Newman]
MLSVAIIGPGAVGTTIAYELQQSLPHTTLIGRHAKTITYYTVPHAPAQDIVVKGYEDVTN
TFDVIIIAVKTHQLDAVIPHLTHLAHEDTLIILAQNGYGQLEHISFKNVCQAVVYISGQK
KGDVVTHFRDYQLRIQDNALTRQFRDLVQDSQIDIVLEANIQQAIWYKLLVNLGINSITA
LGRQTVAIMHNPEIRTLCRQLLLDGCRVAQAEGLNFSEQTVDTIMTIYQGYPDEMGTSMY
YDIAHQQPLEVEAIQGFIYRRAREHNLDTPYLDTIYSFLRAYQQNM