Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|426430.8.peg.2702 PhnB protein; putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein [Staphylococcus aureus subsp. aureus str. Newman]
MTALFPYIAFENSKEALAYYEEVFGATDVKRLEVGEEQASHFGMTKEEAQEATMHAEFEV
LGVKVLCSDSFGRADKINNGISLLIDYDVNNKEDADKVEAFYEQIKDHSSIEIELPFADQ
FWGGKMGVFTDKYGVRWMLHGQDYTAIQQ