Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|426430.8.peg.2637 Doubtful CDS [Staphylococcus aureus subsp. aureus str. Newman]
MLRLSIIFIAFIINTTITYGYTTEGTWVNLLFKSLSLSMIIVFMFYYIRFVIEKKR