Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|426430.8.peg.2565 Ferredoxin-dependent glutamate synthase (EC 1.4.7.1) [Staphylococcus aureus subsp. aureus str. Newman]
MTFLTVMQFIVNIIVVGFMLTVIVIGLIWLIKDKRQSQHSVLRNYPLLARIRYISEKMGP
ELRQYLFSGDNEGKPFSRNDYKNIVLAGKYNSRMTSFGTTKDYQDGFYIQNTMFPMQRNE
ISVDNTTLLSTFIYKIANERLFSREEYRVPTKIDPYYLSDDHAIKLGEHLKHPFILKRIV
GQSGMSYGALGKNAITALSKGLAKAGTWMNTGEGGLSEYHLKGNGDIIFQIGPGLFGVRD
KEGNFSEGLFKEVAQLSNVRAFELKLAQGAKTRGGHMEAEKVNEEIAKIRNVEPYKTINS
PNRYEFIHNAEDLIRFVDQLQQLGQKPVGFKIVVSKVSEIETLVRTMVELDKYPSFITID
GGEGGTGATFQELQDGVGLPLFTALPIVSGMLEKYGIRDKVKLAASGKLVTPDKIAIALG
LGADFVNIARGMMISVGCIMSQQCHMNTCPVGVATTDAKKEKALIVGEKQYRVTNYVTSL
HEGLFNIAAAVGVSSPTEITADHIVYRKVDGELQTIHDYKLKLIS