Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|426430.8.peg.2549 Choline ABC transport system, permease protein OpuBD [Staphylococcus aureus subsp. aureus str. Newman]
MEGNLLQQLFNYYVTNFGYLWDLFFKHLLMSVYGVLFAALIGIPLGILLARYTKLSGFVI
TIANIIQTVPVIAMLAILMLVMGLGSETVVLTVFLYALLPIIKNTYTGIASVDANIKDAG
KGMGMTRNQVLRMIELPLSVSVIIGGIRIALVVAIGVVAVGSFIGAPTLGDIVIRGTNAT
DGTTFILAGAIPIAIIAIVIDVLLRFLEKRLDPTTRHRKNQSNHRPQSINM