Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|426430.8.peg.2510 Protein-disulfide isomerase, related to DsbA [Staphylococcus aureus subsp. aureus str. Newman]
MTKKLLTLFIVSMLILTACGKKESATTSSKNGKPLVVVYGDYKCPYCKELDEKVMPKLRK
NYIDNHKVEYQFVNLAFLGKDSIVGSRASHAVLMYAPKSFLDFQKQLFAAQQDENKEWLT
KELLDKHIKQLHLDKETENKIIKDYKTKDSKSWKAAEKDKKIAKDNHIKTTPTAFINGEK
VEDPYDYESYEKLLKDKIK