Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|426430.8.peg.2506 Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18) [Staphylococcus aureus subsp. aureus str. Newman]
MTIKVEDNKIIFSRTIEAPIEKVFDAYTTKALFEKWFHPKDASTKVFRFNAVSGGDAFYA
IKTPTMTSYTLAEYKTVKRPYLIEYIDSFATPQGAKDTKMPSMKITLSFSKSNTTKTTVT
STSVFPTKEAAQQVINMGVEQGMNQTLDQLDALLK