Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|426430.8.peg.1918 Phage phi 11 orf46 protein homolog [Staphylococcus aureus subsp. aureus str. Newman]
MEITVNDKNEVIGYVNTGGLRNSLDVDDNNVPIKFKEEFEPRKFVFTNGEIKYNSNFEKE
DVPNASNQQSASDLSDEELRGMVASMQMQMTQVNMLTMQLTQQNAMLTQQLTELKTNKTN
TEGDV