Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|426430.8.peg.1780 Hypothetical protein SAV1752 [Staphylococcus aureus subsp. aureus str. Newman]
MAKGNLFKAILGIGGAVAAVLVTRKDSRDKLKAEYNKYKQDPQSYKDNAKDKATQLGTIA
NETIKEVKTNPKEYANRLKNNPKAFFKEEKSKFTEYDNKTDESIEKGKFDDEGGAAPNNN
LRIVTEEDLKKNKNALSDKE