Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|426430.8.peg.1596 Glycyl-tRNA synthetase (EC 6.1.1.14) [Staphylococcus aureus subsp. aureus str. Newman]
MAKDMDTIVSLAKHRGFVFPGSDIYGGLSNTWDYGPLGVELKNNVKKAWWQKFITQSPFN
VGIDAAILMNPKVWEASGHLNNFNDPMIDNKDSKIRYRADKLIEDYMQDVKGDENFIADG
LSFEQMKKIIDDEGIVCPVSKTANWTEIRQFNLMFKTFQGVTEDSTNEIFLRPETAQGIF
VNYKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFIFRTREFEQMELEFFCKPGEEIEWQN
YWKTFASDWLTSLNMSSENMRLRDHDEDELSHYSNATTDIEYKFPFGWGELWGIASRTDF
DLRKHAEHSGEDFRYHDPETNEKYIPYCIEPSLGADRVTLAFLCDAYDEEGVEGSKDART
VLHFHPALAPYKAAILPLSKKLSGEAIKIFEQLSSKFSIDFDESQSIGKRYRRQDEIGTP
YCVTFDFDSLEDNQVTVRDRDSMEQVRMPISELEAFLTEKTKF