Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|426430.8.peg.1076 Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B] [Staphylococcus aureus subsp. aureus str. Newman]
MEENKTLKEYLRNFLEGYKYVVENRYIYQFSSNPEAFPFMRKDDYKISIFYLNQSFFEEP
CIVVISNDSKLKEIYNFRNTDIKHLSKHFTSYIYDSKKYVEEQSGLLDFNNYIYYTSIYY
GKYIGTVIIQNNLDLFFNYGKRLANDHYNTLISKSKEKLINKAHDEIQPFNHLDLNSMKK
IVDDITFSYQIEQGLQAYKRELYLPAAATFAVAIETFLIKLKKVNKIKHKDTDSTMYTKL
LGELTKEGKVNYRTKKRVEIAYSMRNIINHSQAGAVAKGDCDFLLNTLKDIVDENERILT
EYSKSINKTE