Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|411474.6.peg.1490 Cysteine synthase (EC 2.5.1.47) [Coprococcus eutactus ATCC 27759]
MAKIASQLTELIGNTPLLELTNYEKELGLKAHIVAKLEYFNPLGSVKDRVAAAMIEQGIR
DGLINQDTVIIEPTSGNTGIGLAFVSAAKGLHLILTMPDTMSVERRKIVSALGAEIVLTP
GREGMKGAIAKANELKEQYGNAFIPQQFENKANPAIHKKTTAEEIWRDTDGKVDAFVSAV
GTGGTATGTGSGLKEHNPKVKLIAVEPADSPVLSGGAPGPHKIQGIGAGFIPGVMDLSIV
DEIIRIQNDDAFDTARKIAKTDGVLVGISAGAALYAATELAKRPEYEGKTIVVLFPDTGE
RYLSTSLFNL