Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|349106.5.peg.813 Tryptophan synthase beta chain (EC 4.2.1.20) [Psychrobacter sp. PRwf-1]
MKKIMTTFDNIPHNDEIDDIQDFNQYPDASGHFGIHGGRFVSETLMAALEELETLYYQVK
QDPAFWQEYHNDLVNYVGRPTPLYHAKRLSDEIGGAQIYFKREDLNHTGAHKVNNTIGQA
LLAKMSGKKRIIAETGAGQHGVATATIAARLGLECIIYMGADDVERQKMNVYRMRLLGAK
VVAVESGSRTLKDAMNEAMRDWVTNVDTTYYIIGTVAGPHPYPLLVRDFQAIIGKEARLQ
HLEKTGKLPDALVACVGGGSNAIGLFYEFLNDTDVKMYGVEATGDGIETGRHSAPLAAGR
VGVLHGNRTYLMADDDGQILETHSISAGLDYPGVGPEHSFLKDVKRVEYVGCTDKEALHG
FHEVTRKEGIIPALESSHAVAYALQLAKTMSPEQSIIVNMSGRGDKDLHSVMKAEGIEL