Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|330779.3.peg.63 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17) [Sulfolobus acidocaldarius DSM 639]
MSYLNYFDQIVKVHESIKQYIHKTPLDYSSTFSNIAGAKVYLKMENLQKTGSFKVRGAFS
KLISLSQAERERGVIAVSAGNHAQGVAYAASVLGIKSTVVMPETAPISKYLATKNYGANV
ILHGKFLHESMKKAEEIIRETNAVLVHPYDDLNVILGQGTLGLELLEAEPDVVVVPIGGG
GLISGISIALKAKRNNLKVIGVQSSASPSMKVSVELGRLVEIEPSFSIADGILVKNPSKI
TYEVISELVDDIVLVDDEDIANAILYLLERNKTIAEGAGAASVAAIISGKIKVGNGKKVI
PIISGGNIDMSLLARIIDRMLFKSKRVVKVKVLVPDKPGYLNRVLSRVAQIRGNVIDVIH
DRMSTDVKPGFTKIHVVFEIPVSESLSEFLYSLALDGIEATLVE