Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|321314.4.peg.3594 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17) [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
MHITYDLPVAIEDILEAKKRLAGKIYKTGMPRSNYFSERCKGEIFLKFENMQRTGSFKIR
GAFNKLSSLTEAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVMLKGAPKSKVAATCDY
SAEVVLHGDNFNDTIAKVSEIVETEGRIFIPPYDDPKVIAGQGTIGLEIMEDLYDVDNVI
VPIGGGGLIAGIAIAIKSINPTIKVIGVQAENVHGMAASYYAGEITTHRTTGTLADGCDV
SRPGNLTYEIVRELVDDIVLVSEDEIRNSMIALIQRNKVITEGAGALACAALLSGKLDSH
IQNRKTVSIISGGNIDLSRVSQITGLVDA