Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|316401.4.peg.4196 Branched-chain amino acid ABC transporter, permease protein LivH [Escherichia coli ETEC H10407]
MSEQFLYFLQQMFNGVTLGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVSFMIIAA
LMMMGIDTGWLLVAAGFVGAIVIASAYGWSIERVAYRPVRNSKRLIALISAIGMSIFLQN
YVSLTEGSRDVALPSLFNGQWVVGHSENFSASITTMQAVIWIVTFLAMLALTIFIRYSRM
GRACRACAEDLKMASLLGINTDRVIALTFVIGAAMAAVAGVLLGQFYGVINPYIGFMAGM
KAFTAAVLGGIGSIPGAMIGGLILGIAEALSSAYLSTEYKDVVSFALLILVLLVMPTGIL
GRPEVEKV