Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|306254.1.peg.108 Threonine dehydratase (EC 4.3.1.19) [Campylobacter coli RM2228]
MLELNKIYQAKQKIADFVSKTPFIHSSFLSELCKSEVYLKNENLQITGAYKIRGAYNKIA
NLDPEAKKAGVIAASAGNHAQGVAISAKKFDTKAIIVMPESTPLLKVSATKSLGAEVILK
GDNFDEAYAFATNYAKENGLSFIHPFEDELVMAGQGTLMLEMLDDVSDLDTIIAPVGGGG
LISGIASAAKQINPNIKIIAVGAKGAPAMHDSFKAKEVKNSKSVRTIADGIAVRDANPIN
LGIILECVNEFVQVDDEEIANAVLFLLEKHKIIVEGAGAASVAALLHQKIDIKDSKKIGV
VLSGGNIDVQMLNIIIEKGLFKAYRKMQINVTLIDKPGSLLNLTDSLKSANANIVKIDYD
RFSTKLDYGDAMISITLETKGKEHQEEVRNILKDKGFDFYETF