Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|158879.11.peg.541 Deoxyguanosine kinase (EC 2.7.1.113) # yaaG [Staphylococcus aureus subsp. aureus N315]
MNKPFIAIEGPIGVGKSSLAHKLSQTLDFYEEKEIITENPFLSDFYEDISKWSFQTEMFF
LCNRYKQFQDVTQLNQGVVSDYHIHKNKIFAKNTLSPVEFQKFSKIYDILTEDMIMPNMI
IFLDADLDVLKSRIAKRNRSFEHQIEDEYLLKLKKDYREYYESLQSNGSNVVLIDTTSID
FLKNEQDYEDILHIILPMIGDITNE