Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|158879.11.peg.2727 Arsenite/antimonite:H+ antiporter ArsB (EC 7.3.2.7) [Staphylococcus aureus subsp. aureus N315]
MTILAIVIFLLTLTFVIWQPKGLDIGITALIGAVVAIITGVVSLSDVLEVTGIVWNATLT
FVAVILISLILDEIGFFEWSAIHMVKASNGNGLKMFVFIMLLGAIVAAFFANDGAALILT
PIVLAMVRNLGFNQKVIFPFIIASGFIADTTSLPLIVSNLVNIVSADYFDIGFIEYFSRM
IIPNIFSLIASILVLWLYFRKSIPKTFDTENLSDPKSAIKDSKLFKLSWIVLAVLLVGYL
VSEFIQIPVSIIAGIIAFIFVILARKSKAVHTKQVIKGAPWNIVVFSIGMYLVVFGLKNV
GITTVLGDVLTNISNYGLFSSIMGMGFIAAFLSSIMNNMPTVLIDAIAIGQSSATGILKE
GMVYANVIGSDLGPKITPIGSLATLLWLHVLTQKGVKISWGTYFKTGIIITIPVLFVTLL
GLYLTLIIF