Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|158879.11.peg.2303 Urocanate hydratase (EC 4.2.1.49) [Staphylococcus aureus subsp. aureus N315]
MRKIQAKKGLSIECKGWEQEAVLRMLYNNLDPEVAERPEDLVVYGGIGKAARNWEAFEAI
EKTLRELESDETMLVQSGKPVAVFKTHEEAPRVLISNSVLVPEWANWDHFNELDKKGLIM
YGQMTAGSWIYIGSQGIVQGTYETFAELGNQHFNGDLAGTVTLTAGLGGMGGAQPLAITM
NHGVAICVDVDETRVDKRIDTKYCDVKTADLDEALKLAEEAKERGEGLSIGLVGNAVDIH
QAILEKGFKIDIITDQTSAHDPLNGYVPQGYSVEEAKVLREKDPKKYVELSQASMAKHVE
LMLEFQKRGAVAFDYGNNIRQVAFNNGVKNAFDFPGFVPAYIRPLFCEGKGPFRFAALSG
DPKDIERADEEMRKLFPENEKLLRWLDLAEEKISYQGLPSRIAWLGYGERAKMGLALNRL
VRDGEISAPIVIGRDHLDAGSVASPNRETESMKDGSDAVGDWAVLNALINTAAGGSWISF
HHGGGVGMGYSLHAGMVVVADGSERAERRLERVLTTDPGMGVARHVDAGYDIAIQTAKEK
GIHIPMIDKAGDK