Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|158879.11.peg.1976 Hypothetical SAV0794 homolog in superantigen-encoding pathogenicity islands SaPI [Staphylococcus aureus subsp. aureus N315]
MNLETIVNQFETRAGTLLRYYTGLLEHSKVQPCCFKLYNDPFDMVYVMMNSKLFGHVYIK
DCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKHLSISDMMASHLFEDEYFMYGLQT
YAESNNSDVFEYLENGFDTDTLEGIQSSNTDVIANIEMLYQLATGINEPAPELVEGLKLV
TEFVQDENATQEDYKALERKLNDLKASYYSLSK