Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|158879.11.peg.1552 tRNA 5-hydroxyuridine(34) synthetase TrhP2 [Staphylococcus aureus subsp. aureus N315]
MTELLVTPKSLSHMETLIDLGADAFVIGEQKFGLRLPGEFNRQQMTEAVALAHKNDKKVY
AAVNGLFHNYHLDAVEDYINFLHEIRVDRIIFGDPAVVMYVKAQENPIPLHWNAETLVTN
HFQCNYWGKRGASRAVLARELNLDEIINIKENSNVEIEVQVQGMTCMFQSKRMLLGNYYT
FQDRQMKIERRNDEQSLLLYDEERQNNYPVYEDYNGTHIMSPNDICLIEELAPFFEAGID
SFKIDGILQTEEYINVVTEQYRQAIDLYNEDPEIYEDEKFMLIDPIEEIQPDHRPFDEGF
LYKQTVY