Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|158879.11.peg.1478 Late competence protein ComGB, access of DNA to ComEA [Staphylococcus aureus subsp. aureus N315]
MKLQWINTFKLHSKKRQLSKAQQIDLLSNLCNLLKYGFTLYQSFQFLNLQMTYKNKQLGT
TILSEISNGAPCNQILSLIGYSDTIVMQVYLAERFGNIIDVLEETVNYMKVNRKSEQRLL
KTLQYPLILVSIFIAMIIILNLTVIPQFQQLYTSMNIQLSSFQKTLSFFITSLPTIIVVM
LIIVSMLAIIMKLIYNNLNMLNKINFVMKLPLISGYFQLFKTYFVTNELVLFYKNGITLQ
SIVDVYINHSSDPFRQFLGKYLLTYSEMGYGLPQILEKLKCFKPQLIKFVLQGEKRGKLE
VELKLYSQILVKQIEDKAIKQTQFLQPILFLILGLFIVAIYLVIMLPMFQMMQSIK