Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|158879.11.peg.1403 Heptaprenyl diphosphate synthase component I (EC 2.5.1.30) [Staphylococcus aureus subsp. aureus N315]
METTVSKLERQIEERLKGVSEYESININHRLGKLLDSYDIPDVAKVACLTIDTSMRHLDD
ITYNHLSKHSILIGDLISAHFYTLLAEINDLSFQNEISKAIVEINELKSSLHHQALNDYE
ISQAIVKIETLFPYITLSHFGINIDESEIYNYLFEDMSDYYPSYFKKYNQSEVKHYLHDI
QKSYLKSRGN