Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|158879.11.peg.1291 Prephenate dehydrogenase (EC 1.3.1.12) # TyrAp/ACT domain, NAD-specific [Staphylococcus aureus subsp. aureus N315]
MTTVLFVGLGLIGGSLASNIKYHNPNTNIIAYDADTSQLDKAKSIGIINEKCLNYSEAIK
KADVIIYATPVAITNKYLSELIDMPTKPGVIVSDTGSTKAMIQQHESNLLKHNIHLVSGH
PMAGSHKSGVLNAKKHLFENAYYILVYNEPRNEQAANTLKELLSPTLAKFIVTTAEEHDY
VTSVVSHLPHIVASSLVHVSQKNGQEHHLVNKLAAGGFRDITRIASSNAQMWKDITLSNK
TYILEMIRQLKSQFQDLERLIESNDSEKLLSFFAQAKSYRDALPAKQLGGLNTAYDLYVD
IPDESGMISKVTYIMSLHNISISNLRILEVREDIYGALKISFKNPTDRERGMQALSDFDC
YIQ