Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|1116050.3.peg.3557 hypothetical protein [Escherichia coli P0299917.4]
MSPVSSIGNDISSDLVRRKMNDLPESPIGNNLEALAPGIEKLKQTSIQMVTLVMLPTY