Display fasta sequences

DNA Sequence: DNA Sequence with flanking: bases Protein Sequence

>fig|1116050.3.peg.3549 2-iminobutanoate/2-iminopropanoate deaminase RidA/TdcF (EC 3.5.99.10) [Escherichia coli P0299917.4]
MKKIIETQRAPGAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAI
VVAAGLSVGDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLE
IEAIAVRSA