Protein Sequence for fig|979215.3.peg.2189 from Staphylococcus epidermidis NIHLM018

>fig|979215.3.peg.2189 FIG01108236: hypothetical protein
MEKSVKLAVGIYLAIILIICSIYLAFILIGSLSGKDMSNSVLDTDHSRINNTSRNSNEDV
TSSNNESNNTKAHSFSNSEYKAVNINEAYKNNKHIKKANSSYQYY