Protein Sequence for fig|979211.3.peg.2267 from Staphylococcus epidermidis NIHLM023

>fig|979211.3.peg.2267 Hypothetical protein SAV2327
MKAYLYKFMPLLILVIGLIILYVINDYPTLLHVIVIIVFITSGLKNVYFVNNNIRNHIIW
MSPKLDRILGMLSGILYSGIYWVSFIKQQPLWIVILILVLTVGTAVLLETKLHITSLQLE
ERLSSERIKRKVISRHKAQRLKNIFFTVIVVVIISMLISLYLKLMVIFGIALAIFILASI
SVAIFEKYFTIYWKYVNYY