Protein Sequence for fig|93062.19.peg.78 from Staphylococcus aureus subsp. aureus COL

>fig|93062.19.peg.78 hypothetical protein
MTKFDKNDKGTWIIGSEMATQNKGEALKVKGMVLYMNRNTKTTKGYYYVNAIKNDKDGRP
QENEKRYPVKMVDNKIIPTKEIKDKNIKKEIENFKFFVQYGNFKDLSKYKDGDISYNPEV
PSYSAKYQLTNDDYNVKQLRKRYDIPTNKAPKLLLKGTGNLKGSSVGYKDIEFTFVEKKE
ENIYFSDGLIFKPSEDK