Protein Sequence for fig|93062.19.peg.374 from Staphylococcus aureus subsp. aureus COL

>fig|93062.19.peg.374 Phage holin
MDAKVITRYIVLILALVNQFLANKGISPIPVDEESVSSIILTVVALYTTYKDNPTSQEGK
WANQKLKKYKAESKYRKATGQAPIKEVMTPTNMNDTNDLG