Protein Sequence for fig|93062.19.peg.2479 from Staphylococcus aureus subsp. aureus COL

>fig|93062.19.peg.2479 FIG01107948: hypothetical protein
MEAIKVQLSHSVKVAISIYLALIFITFTSYLVIILYTSMTGHDVSHFVLDSQHSHHGSLT
QKHLSLPEISFK