Protein Sequence for fig|93062.19.peg.2378 from Staphylococcus aureus subsp. aureus COL

>fig|93062.19.peg.2378 Teicoplanin resistance transporter, TcaB family => TcaB2
MQSTKTKTKHFSFLLLITLGVMTAFGPLTIDMYVPSLPKVQGDFGSTTSEIQLTLSFTMI
GLALGQFIFGPLSDAFGRKRIAVSILIIFILVSGLSMFVDQLPLFLTLRFIQGLTGGGVI
VIAKASAGDKFSGNALAKFLASLMVVNGIITILAPLAGGLALSVATWRSIFTILTIVALI
ILIGVASQLPKTSKDELKQVNFSSVIKDFGSLLKKPAFIIPMLLQGLTYVMLFSYSSASP
FITQKLYNMTPQQFSIMFAVNGVGLIIVSQVVALLVEKLHRHILLIILTIIQVVGVALII
LTLTFHLPLWVLLIAFFLNVCPVTSIGPLGFTMAMEERTGGSGNASSLLGLFQFILGGAV
APLVGLKGEFNTSPYMIIIFITAILLVSLQIIYFKMIKKQHVA