Protein Sequence for fig|93062.19.peg.2299 from Staphylococcus aureus subsp. aureus COL

>fig|93062.19.peg.2299 Integral membrane protein
MLLNLLLIFILIVICPLIFNYTLTLNLTCYILVVISIFLSLIYSIMTYTFPWSMFVTFII
ISIIMLFKHRYLFSHTSSRLFIKKLLSFSYKFVLYTSALLFISTIQSPIVKGLSMWLAIL
CLSLLLTFICYLVWTVSYRHRSYNKEVDIIIVLGAGIFTEFVTPMLAARLDRALDIYQQQ
ASATKIIVSGGQGPDEPISEALAMQRYLIAHGVDKTDILMESHSINTYTNFLYSKQIINN
LYHEAVKIVCVTSQFHVLRALRLAQKLGLSIDGVGSHTPYHFFLHVLIKDYLGVMYQYRL
LLTLYCSSSWFICLYAAFIYNS